Lineage for d1apnb_ (1apn B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778280Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2778302Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (74 PDB entries)
    Uniprot P81461
  8. 2778353Domain d1apnb_: 1apn B: [23962]
    demetallized, pH 5

Details for d1apnb_

PDB Entry: 1apn (more details), 2.5 Å

PDB Description: the crystallographic structure of metal-free concanavalin a at 2.5 angstroms resolution
PDB Compounds: (B:) concanavalin a

SCOPe Domain Sequences for d1apnb_:

Sequence, based on SEQRES records: (download)

>d1apnb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d1apnb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypnsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavvs
ypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetnal
hfmfnqfskdqkdlilqgdattgtdgnleltrvqgssvgralfyapvhiwessavvasfe
atftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1apnb_:

Click to download the PDB-style file with coordinates for d1apnb_.
(The format of our PDB-style files is described here.)

Timeline for d1apnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1apna_