![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Geobacter metallireducens [TaxId:28232] [233232] (1 PDB entry) |
![]() | Domain d3pefh1: 3pef H:2-162 [239619] Other proteins in same PDB: d3pefa2, d3pefb2, d3pefc2, d3pefd2, d3pefe2, d3peff2, d3pefg2, d3pefh2 automated match to d3pefa1 complexed with edo, gol, nap, peg |
PDB Entry: 3pef (more details), 2.07 Å
SCOPe Domain Sequences for d3pefh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pefh1 c.2.1.0 (H:2-162) automated matches {Geobacter metallireducens [TaxId: 28232]} qkfgfiglgimgsamaknlvkagcsvtiwnrspekaeelaalgaeraatpcevvescpvt famladpaaaeevcfgkhgvlegigegrgyvdmstvdpatsqrigvavvakggrfleapv sgskkpaedgtliilaagdrnlydeampgfekmgkkiihlg
Timeline for d3pefh1: