SCOPe 2.08: Domain d3pefg1: 3pef G:1-162

Lineage for d3pefg1 (3pef G:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Geobacter metallireducens [TaxId:28232] [233232] (1 PDB entry)

8. Domain d3pefg1: 3pef G:1-162 [239617]
   Other proteins in same PDB: d3pefa2, d3pefb2, d3pefc2, d3pefd2, d3pefe2, d3peff2, d3pefg2, d3pefh2
   automated match to d3pefa1
   complexed with edo, gol, nap, peg

Details for d3pefg1

PDB Entry: 3pef, 2.07 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+

PDB Compounds: (G:) 6-phosphogluconate dehydrogenase, NAD-binding

SCOPe Domain Sequences for d3pefg1:

Sequence; same for both SEQRES and ATOM records:

>d3pefg1 c.2.1.0 (G:1-162) automated matches {Geobacter metallireducens [TaxId: 28232]}
sqkfgfiglgimgsamaknlvkagcsvtiwnrspekaeelaalgaeraatpcevvescpv
tfamladpaaaeevcfgkhgvlegigegrgyvdmstvdpatsqrigvavvakggrfleap
vsgskkpaedgtliilaagdrnlydeampgfekmgkkiihlg

Timeline for d3pefg1:

• d3pefg1 first appeared in SCOPe 2.04
  
• d3pefg1 appears in SCOPe 2.07