SCOPe 2.06: Domain d3pefb2: 3pef B:163-287

Lineage for d3pefb2 (3pef B:163-287)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (35 species)
   not a true protein

7. Species Geobacter metallireducens [TaxId:28232] [233234] (1 PDB entry)

8. Domain d3pefb2: 3pef B:163-287 [239608]
   Other proteins in same PDB: d3pefa1, d3pefb1, d3pefc1, d3pefd1, d3pefe1, d3peff1, d3pefg1, d3pefh1
   automated match to d3pefa2
   complexed with edo, gol, nap, peg

Details for d3pefb2

PDB Entry: 3pef, 2.07 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+

PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, NAD-binding

SCOPe Domain Sequences for d3pefb2:

Sequence; same for both SEQRES and ATOM records:

>d3pefb2 a.100.1.0 (B:163-287) automated matches {Geobacter metallireducens [TaxId: 28232]}
dvgkgaemklvvnmvmggmmacfceglalgekaglatdaildvigagamanpmfalkggl
irdrnfapafplkhmqkdlrlavalgdrvgqplvasaaanelfkgaraagfgdedfsaif
ktyer

Timeline for d3pefb2:

• d3pefb2 first appeared in SCOPe 2.04
  
• d3pefb2 appears in SCOPe 2.05
  
• d3pefb2 appears in SCOPe 2.07
  
• d3pefb2 appears in the current release, SCOPe 2.08