Lineage for d3pduh1 (3pdu H:2-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846943Species Geobacter sulfurreducens [TaxId:35554] [233218] (1 PDB entry)
  8. 2846951Domain d3pduh1: 3pdu H:2-163 [239605]
    Other proteins in same PDB: d3pdua2, d3pdua3, d3pdub2, d3pdub3, d3pduc2, d3pduc3, d3pdud2, d3pdud3, d3pdue2, d3pdue3, d3pduf2, d3pduf3, d3pdug2, d3pduh2, d3pduh3
    automated match to d3pduc1
    complexed with gol, nap

Details for d3pduh1

PDB Entry: 3pdu (more details), 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+
PDB Compounds: (H:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pduh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pduh1 c.2.1.0 (H:2-163) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlge

SCOPe Domain Coordinates for d3pduh1:

Click to download the PDB-style file with coordinates for d3pduh1.
(The format of our PDB-style files is described here.)

Timeline for d3pduh1: