SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3p9sd2 (3p9s D:598-753)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104743Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2104744Protein automated matches [190197] (20 species)
    not a true protein
  7. 2104759Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries)
  8. 2104827Domain d3p9sd2: 3p9s D:598-753 [239602]
    Other proteins in same PDB: d3p9sa1, d3p9sb1, d3p9sc1, d3p9sd1
    automated match to d3p9sa2
    complexed with hdd, hde

Details for d3p9sd2

PDB Entry: 3p9s (more details), 1.9 Å

PDB Description: Structure of I274A variant of E. coli KatE
PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d3p9sd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9sd2 c.23.16.0 (D:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3p9sd2:

Click to download the PDB-style file with coordinates for d3p9sd2.
(The format of our PDB-style files is described here.)

Timeline for d3p9sd2: