Lineage for d3p05e1 (3p05 E:1-147)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495228Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1495229Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1495230Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1495354Protein automated matches [190369] (6 species)
    not a true protein
  7. 1495355Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)
  8. 1495368Domain d3p05e1: 3p05 E:1-147 [239595]
    Other proteins in same PDB: d3p05a2, d3p05b2, d3p05c2, d3p05e2
    automated match to d3p05b1
    complexed with iod

Details for d3p05e1

PDB Entry: 3p05 (more details), 2.5 Å

PDB Description: X-ray structure of pentameric HIV-1 CA
PDB Compounds: (E:) hiv-1 ca

SCOPe Domain Sequences for d3p05e1:

Sequence, based on SEQRES records: (download)

>d3p05e1 a.73.1.1 (E:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d3p05e1 a.73.1.1 (E:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pihqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqml
ketineeaaewdrlhpreprgsdiagttstlqeqigwmthnppipvgeiykrwiilglnk
ivrmysp

SCOPe Domain Coordinates for d3p05e1:

Click to download the PDB-style file with coordinates for d3p05e1.
(The format of our PDB-style files is described here.)

Timeline for d3p05e1: