Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.1: double-SIS domain [53698] (5 proteins) duplication: consists of two SIS domains related by pseudo dyad |
Protein automated matches [227069] (2 species) not a true protein |
Domain d3oojh2: 3ooj H:241-608 [239592] Other proteins in same PDB: d3ooja1, d3oojb1, d3oojc1, d3oojd1, d3ooje1, d3oojf1, d3oojg1, d3oojh1 automated match to d3oojb2 complexed with g6p, g6q, glu, gol; mutant |
PDB Entry: 3ooj (more details), 2.5 Å
SCOPe Domain Sequences for d3oojh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oojh2 c.80.1.1 (H:241-608) automated matches {Escherichia coli [TaxId: 562]} dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn laksvtve
Timeline for d3oojh2: