SCOPe 2.04: Domain d3oojh2: 3ooj H:241-608

Lineage for d3oojh2 (3ooj H:241-608)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.1: double-SIS domain [53698] (5 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein automated matches [227069] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [233109] (4 PDB entries)

8. Domain d3oojh2: 3ooj H:241-608 [239592]
   Other proteins in same PDB: d3ooja1, d3oojb1, d3oojc1, d3oojd1, d3ooje1, d3oojf1, d3oojg1, d3oojh1
   automated match to d3oojb2
   complexed with g6p, g6q, glu, gol; mutant

Details for d3oojh2

PDB Entry: 3ooj, 2.5 Å

PDB Description: c1a mutant of e. coli glms in complex with glucose-6p and glutamate

PDB Compounds: (H:) Glucosamine/fructose-6-phosphate aminotransferase, isomerizing

SCOPe Domain Sequences for d3oojh2:

Sequence; same for both SEQRES and ATOM records:

>d3oojh2 c.80.1.1 (H:241-608) automated matches {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

Timeline for d3oojh2:

• d3oojh2 is new in SCOPe 2.04-stable
  
• d3oojh2 appears in SCOPe 2.05
  
• d3oojh2 appears in the current release, SCOPe 2.08