| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
| Protein automated matches [190509] (9 species) not a true protein |
| Domain d3oojd1: 3ooj D:1-235 [239583] Other proteins in same PDB: d3ooja2, d3oojb2, d3oojc2, d3oojd2, d3ooje2, d3oojf2, d3oojg2, d3oojh2 automated match to d3oojb1 complexed with g6p, g6q, glu, gol; mutant |
PDB Entry: 3ooj (more details), 2.5 Å
SCOPe Domain Sequences for d3oojd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oojd1 d.153.1.0 (D:1-235) automated matches {Escherichia coli [TaxId: 562]}
agivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdie
Timeline for d3oojd1: