Lineage for d3omnb1 (3omn B:30-129)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024153Protein automated matches [233090] (1 species)
    not a true protein
  7. 3024154Species Rhodobacter sphaeroides [TaxId:272943] [233091] (6 PDB entries)
  8. 3024159Domain d3omnb1: 3omn B:30-129 [239579]
    Other proteins in same PDB: d3omna_, d3omnb2, d3omnb3, d3omnc_, d3omnd2, d3omnd3
    automated match to d3om3d1
    complexed with ca, cd, cl, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omnb1

PDB Entry: 3omn (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation in the reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omnb1 f.17.2.1 (B:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d3omnb1:

Click to download the PDB-style file with coordinates for d3omnb1.
(The format of our PDB-style files is described here.)

Timeline for d3omnb1: