SCOPe 2.05: Domain d3omad2: 3oma D:130-285

Lineage for d3omad2 (3oma D:130-285)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein automated matches [233094] (2 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [233095] (4 PDB entries)

8. Domain d3omad2: 3oma D:130-285 [239574]
   Other proteins in same PDB: d3omaa_, d3omab1, d3omac_, d3omad1
   automated match to d3om3d2
   complexed with ca, cd, cu, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omad2

PDB Entry: 3oma, 2.3 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation

PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omad2:

Sequence; same for both SEQRES and ATOM records:

>d3omad2 b.6.1.2 (D:130-285) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqhhhh

Timeline for d3omad2:

• d3omad2 first appeared in SCOPe 2.04
  
• d3omad2 appears in SCOPe 2.06
  
• d3omad2 appears in the current release, SCOPe 2.08