![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein automated matches [233094] (2 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:272943] [233095] (6 PDB entries) |
![]() | Domain d3omad2: 3oma D:130-281 [239574] Other proteins in same PDB: d3omaa_, d3omab1, d3omab3, d3omac_, d3omad1, d3omad3 automated match to d3om3d2 complexed with ca, cd, cu, cu1, dmu, hea, hth, mg, oh, trd; mutant |
PDB Entry: 3oma (more details), 2.3 Å
SCOPe Domain Sequences for d3omad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omad2 b.6.1.2 (D:130-281) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff gqcselcgishaympitvkvvseeayaawleq
Timeline for d3omad2: