Lineage for d3omab2 (3oma B:130-281)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771215Protein automated matches [233094] (2 species)
    not a true protein
  7. 2771231Species Rhodobacter sphaeroides [TaxId:272943] [233095] (6 PDB entries)
  8. 2771240Domain d3omab2: 3oma B:130-281 [239572]
    Other proteins in same PDB: d3omaa_, d3omab1, d3omab3, d3omac_, d3omad1, d3omad3
    automated match to d3om3d2
    complexed with ca, cd, cu, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omab2

PDB Entry: 3oma (more details), 2.3 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omab2 b.6.1.2 (B:130-281) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

SCOPe Domain Coordinates for d3omab2:

Click to download the PDB-style file with coordinates for d3omab2.
(The format of our PDB-style files is described here.)

Timeline for d3omab2: