Lineage for d3omab1 (3oma B:30-129)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024153Protein automated matches [233090] (1 species)
    not a true protein
  7. 3024154Species Rhodobacter sphaeroides [TaxId:272943] [233091] (6 PDB entries)
  8. 3024163Domain d3omab1: 3oma B:30-129 [239571]
    Other proteins in same PDB: d3omaa_, d3omab2, d3omab3, d3omac_, d3omad2, d3omad3
    automated match to d3om3d1
    complexed with ca, cd, cu, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omab1

PDB Entry: 3oma (more details), 2.3 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omab1 f.17.2.1 (B:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d3omab1:

Click to download the PDB-style file with coordinates for d3omab1.
(The format of our PDB-style files is described here.)

Timeline for d3omab1: