Lineage for d3oeew1 (3oee W:8-82)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795900Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1795901Protein automated matches [254527] (7 species)
    not a true protein
  7. 1795909Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)
  8. 1795932Domain d3oeew1: 3oee W:8-82 [239557]
    Other proteins in same PDB: d3oeed2, d3oeed3, d3oeee2, d3oeee3, d3oeef2, d3oeef3, d3oeeg_, d3oeem2, d3oeem3, d3oeen2, d3oeen3, d3oeeo2, d3oeeo3, d3oeep_, d3oeev2, d3oeev3, d3oeew2, d3oeew3, d3oeex2, d3oeex3, d3oeey_
    automated match to d2jdid2
    complexed with anp, mg, po4; mutant

Details for d3oeew1

PDB Entry: 3oee (more details), 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S
PDB Compounds: (W:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeew1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeew1 b.49.1.0 (W:8-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
eglvrgekvldtggp

SCOPe Domain Coordinates for d3oeew1:

Click to download the PDB-style file with coordinates for d3oeew1.
(The format of our PDB-style files is described here.)

Timeline for d3oeew1: