Lineage for d1cvna_ (1cvn A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12396Protein Concanavalin A [49901] (2 species)
  7. 12402Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (38 PDB entries)
  8. 12430Domain d1cvna_: 1cvn A: [23955]

Details for d1cvna_

PDB Entry: 1cvn (more details), 2.3 Å

PDB Description: concanavalin a complexed to trimannoside

SCOP Domain Sequences for d1cvna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvna_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1cvna_:

Click to download the PDB-style file with coordinates for d1cvna_.
(The format of our PDB-style files is described here.)

Timeline for d1cvna_: