SCOPe 2.04: Domain d3oeen1: 3oee N:6-82

Lineage for d3oeen1 (3oee N:6-82)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)

8. Domain d3oeen1: 3oee N:6-82 [239548]
   Other proteins in same PDB: d3oeed2, d3oeed3, d3oeee2, d3oeee3, d3oeef2, d3oeef3, d3oeeg_, d3oeem2, d3oeem3, d3oeen2, d3oeen3, d3oeeo2, d3oeeo3, d3oeep_, d3oeev2, d3oeev3, d3oeew2, d3oeew3, d3oeex2, d3oeex3, d3oeey_
   automated match to d2jdid2
   complexed with anp, mg, po4; mutant

Details for d3oeen1

PDB Entry: 3oee, 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S

PDB Compounds: (N:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeen1:

Sequence; same for both SEQRES and ATOM records:

>d3oeen1 b.49.1.0 (N:6-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
gteglvrgekvldtggp

Timeline for d3oeen1:

• d3oeen1 is new in SCOPe 2.04-stable
  
• d3oeen1 appears in SCOPe 2.05
  
• d3oeen1 appears in the current release, SCOPe 2.08