Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (9 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries) |
Domain d3oeed2: 3oee D:83-357 [239537] Other proteins in same PDB: d3oeed1, d3oeed3, d3oeee1, d3oeee3, d3oeef1, d3oeef3, d3oeeg_, d3oeem1, d3oeem3, d3oeen1, d3oeen3, d3oeeo1, d3oeeo3, d3oeep_, d3oeev1, d3oeev3, d3oeew1, d3oeew3, d3oeex1, d3oeex3, d3oeey_ automated match to d2jdid3 complexed with anp, mg, po4; mutant |
PDB Entry: 3oee (more details), 2.74 Å
SCOPe Domain Sequences for d3oeed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeed2 c.37.1.11 (D:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap attfahldattvlsrgiselgiypavdpldsksrl
Timeline for d3oeed2:
View in 3D Domains from other chains: (mouse over for more information) d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeg_, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3, d3oeey_ |