SCOPe 2.05: Domain d3nzxt_: 3nzx T:

Lineage for d3nzxt_ (3nzx T:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (12 PDB entries)

8. Domain d3nzxt_: 3nzx T: [239532]
   Other proteins in same PDB: d3nzx1_, d3nzx2_, d3nzxa_, d3nzxb_, d3nzxc_, d3nzxd_, d3nzxe_, d3nzxg_, d3nzxh_, d3nzxi_, d3nzxj_, d3nzxk_, d3nzxl_, d3nzxm_, d3nzxn_, d3nzxo_, d3nzxp_, d3nzxq_, d3nzxr_, d3nzxs_, d3nzxu_, d3nzxv_, d3nzxw_, d3nzxx_, d3nzxy_, d3nzxz_
   automated match to d1irug_

Details for d3nzxt_

PDB Entry: 3nzx, 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with ligand 2c

PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d3nzxt_:

Sequence; same for both SEQRES and ATOM records:

>d3nzxt_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

Timeline for d3nzxt_:

• d3nzxt_ first appeared in SCOPe 2.04
  
• d3nzxt_ appears in SCOPe 2.06
  
• d3nzxt_ appears in the current release, SCOPe 2.08