Lineage for d3nzxt_ (3nzx T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2995925Domain d3nzxt_: 3nzx T: [239532]
    Other proteins in same PDB: d3nzx1_, d3nzx2_, d3nzxa_, d3nzxb_, d3nzxc1, d3nzxc2, d3nzxd_, d3nzxe_, d3nzxg_, d3nzxh_, d3nzxi_, d3nzxj_, d3nzxk_, d3nzxl_, d3nzxm_, d3nzxn_, d3nzxo_, d3nzxp_, d3nzxq1, d3nzxq2, d3nzxr_, d3nzxs_, d3nzxu_, d3nzxv_, d3nzxw_, d3nzxx_, d3nzxy_, d3nzxz_
    automated match to d1irug_

Details for d3nzxt_

PDB Entry: 3nzx (more details), 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with ligand 2c
PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d3nzxt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzxt_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d3nzxt_:

Click to download the PDB-style file with coordinates for d3nzxt_.
(The format of our PDB-style files is described here.)

Timeline for d3nzxt_: