SCOPe 2.08: Domain d3nzxk_: 3nzx K:

Lineage for d3nzxk_ (3nzx K:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d3nzxk_: 3nzx K: [239531]
   Other proteins in same PDB: d3nzx1_, d3nzxa_, d3nzxc2, d3nzxe_, d3nzxf_, d3nzxi_, d3nzxj_, d3nzxm_, d3nzxo_, d3nzxq2, d3nzxs_, d3nzxt_, d3nzxw_, d3nzxx_
   automated match to d4g4sl_

Details for d3nzxk_

PDB Entry: 3nzx, 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with ligand 2c

PDB Compounds: (K:) Proteasome component PRE2

SCOPe Domain Sequences for d3nzxk_:

Sequence; same for both SEQRES and ATOM records:

>d3nzxk_ d.153.1.4 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d3nzxk_:

• d3nzxk_ first appeared in SCOPe 2.04
  
• d3nzxk_ appears in SCOPe 2.07