Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d3nzxk_: 3nzx K: [239531] Other proteins in same PDB: d3nzx1_, d3nzxa_, d3nzxc2, d3nzxe_, d3nzxf_, d3nzxi_, d3nzxj_, d3nzxm_, d3nzxo_, d3nzxq2, d3nzxs_, d3nzxt_, d3nzxw_, d3nzxx_ automated match to d4g4sl_ |
PDB Entry: 3nzx (more details), 2.7 Å
SCOPe Domain Sequences for d3nzxk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nzxk_ d.153.1.4 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv tedgwiyhgnhdvgelfwkvkeeegsfnnvig
Timeline for d3nzxk_:
View in 3D Domains from other chains: (mouse over for more information) d3nzx1_, d3nzx2_, d3nzxa_, d3nzxb_, d3nzxc1, d3nzxc2, d3nzxd_, d3nzxe_, d3nzxf_, d3nzxg_, d3nzxh_, d3nzxi_, d3nzxj_, d3nzxl_, d3nzxm_, d3nzxn_, d3nzxo_, d3nzxp_, d3nzxq1, d3nzxq2, d3nzxr_, d3nzxs_, d3nzxt_, d3nzxu_, d3nzxv_, d3nzxw_, d3nzxx_, d3nzxy_, d3nzxz_ |