Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d3nzjh_: 3nzj H: [239518] Other proteins in same PDB: d3nzj1_, d3nzja_, d3nzje_, d3nzjf_, d3nzji_, d3nzjj_, d3nzjm_, d3nzjo_, d3nzjs_, d3nzjt_, d3nzjw_, d3nzjx_ automated match to d4eu2i_ complexed with mes |
PDB Entry: 3nzj (more details), 2.4 Å
SCOPe Domain Sequences for d3nzjh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nzjh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d3nzjh_:
View in 3D Domains from other chains: (mouse over for more information) d3nzj1_, d3nzj2_, d3nzja_, d3nzjb_, d3nzjc_, d3nzjd_, d3nzje_, d3nzjf_, d3nzjg_, d3nzji_, d3nzjj_, d3nzjk_, d3nzjl_, d3nzjm_, d3nzjn_, d3nzjo_, d3nzjp_, d3nzjq_, d3nzjr_, d3nzjs_, d3nzjt_, d3nzju_, d3nzjv_, d3nzjw_, d3nzjx_, d3nzjy_, d3nzjz_ |