| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
| Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
| Protein automated matches [232090] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries) |
| Domain d3nvvk2: 3nvv K:415-528 [239514] Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb1, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk1, d3nvvl1, d3nvvl2 automated match to d3nvvb2 complexed with ast, fad, fes, mos, mte |
PDB Entry: 3nvv (more details), 1.82 Å
SCOPe Domain Sequences for d3nvvk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvvk2 d.87.2.0 (K:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3nvvk2: