| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
| Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
| Protein automated matches [230465] (4 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries) |
| Domain d3nvvc1: 3nvv C:571-694 [239509] Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb1, d3nvvb2, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk1, d3nvvk2, d3nvvl2 automated match to d3etrc1 complexed with ast, fad, fes, mos, mte |
PDB Entry: 3nvv (more details), 1.82 Å
SCOPe Domain Sequences for d3nvvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvvc1 d.41.1.0 (C:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa
Timeline for d3nvvc1: