Lineage for d3nvvc1 (3nvv C:571-694)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2551903Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2551989Family d.41.1.0: automated matches [230464] (1 protein)
    not a true family
  6. 2551990Protein automated matches [230465] (4 species)
    not a true protein
  7. 2551991Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries)
  8. 2551994Domain d3nvvc1: 3nvv C:571-694 [239509]
    Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb1, d3nvvb2, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk1, d3nvvk2, d3nvvl2
    automated match to d3etrc1
    complexed with ast, fad, fes, mos, mte

Details for d3nvvc1

PDB Entry: 3nvv (more details), 1.82 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (C:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvvc1 d.41.1.0 (C:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOPe Domain Coordinates for d3nvvc1:

Click to download the PDB-style file with coordinates for d3nvvc1.
(The format of our PDB-style files is described here.)

Timeline for d3nvvc1: