| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
| Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
| Protein automated matches [232090] (5 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries) |
| Domain d3nrzk2: 3nrz K:415-528 [239506] Other proteins in same PDB: d3nrza1, d3nrza2, d3nrzb1, d3nrzc1, d3nrzc2, d3nrzj1, d3nrzj2, d3nrzk1, d3nrzl1, d3nrzl2 automated match to d3eub32 complexed with fad, fes, hpa, mos, mte |
PDB Entry: 3nrz (more details), 1.8 Å
SCOPe Domain Sequences for d3nrzk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nrzk2 d.87.2.0 (K:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3nrzk2: