SCOPe 2.06: Domain d3nrzk1: 3nrz K:224-414

Lineage for d3nrzk1 (3nrz K:224-414)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
   automatically mapped to Pfam PF00941

6. Protein automated matches [232070] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)

8. Domain d3nrzk1: 3nrz K:224-414 [239505]
   Other proteins in same PDB: d3nrza1, d3nrza2, d3nrzb2, d3nrzc1, d3nrzc2, d3nrzj1, d3nrzj2, d3nrzk2, d3nrzl1, d3nrzl2
   automated match to d3eub31
   complexed with fad, fes, hpa, mos, mte

Details for d3nrzk1

PDB Entry: 3nrz, 1.8 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Hypoxanthine

PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nrzk1:

Sequence; same for both SEQRES and ATOM records:

>d3nrzk1 d.145.1.3 (K:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

Timeline for d3nrzk1:

• d3nrzk1 first appeared in SCOPe 2.04
  
• d3nrzk1 appears in SCOPe 2.05
  
• d3nrzk1 appears in SCOPe 2.07
  
• d3nrzk1 appears in the current release, SCOPe 2.08