![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
![]() | Protein automated matches [232070] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries) |
![]() | Domain d3nrzb1: 3nrz B:224-414 [239501] Other proteins in same PDB: d3nrza1, d3nrza2, d3nrzb2, d3nrzc1, d3nrzc2, d3nrzj1, d3nrzj2, d3nrzk2, d3nrzl1, d3nrzl2 automated match to d3eub31 complexed with fad, fes, hpa, mos, mte |
PDB Entry: 3nrz (more details), 1.8 Å
SCOPe Domain Sequences for d3nrzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nrzb1 d.145.1.3 (B:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]} pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei llsieipysre
Timeline for d3nrzb1: