Lineage for d3nrzb1 (3nrz B:224-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987556Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2987615Protein automated matches [232070] (2 species)
    not a true protein
  7. 2987616Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)
  8. 2987621Domain d3nrzb1: 3nrz B:224-414 [239501]
    Other proteins in same PDB: d3nrza1, d3nrza2, d3nrzb2, d3nrzc1, d3nrzc2, d3nrzj1, d3nrzj2, d3nrzk2, d3nrzl1, d3nrzl2
    automated match to d3eub31
    complexed with fad, fes, hpa, mos, mte

Details for d3nrzb1

PDB Entry: 3nrz (more details), 1.8 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Hypoxanthine
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nrzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrzb1 d.145.1.3 (B:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3nrzb1:

Click to download the PDB-style file with coordinates for d3nrzb1.
(The format of our PDB-style files is described here.)

Timeline for d3nrzb1: