| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
| Domain d3nqua_: 3nqu A: [239498] Other proteins in same PDB: d3nqub_ automated match to d4h9sa_ complexed with so4 |
PDB Entry: 3nqu (more details), 2.5 Å
SCOPe Domain Sequences for d3nqua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nqua_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hllirklpfsrlareicvkftrgvdfnwqaqallalqeaaeaflvhlfedaylltlhagr
vtlfpkdvqlarrirg
Timeline for d3nqua_: