SCOPe 2.06: Domain d3nh7d_: 3nh7 D:

Lineage for d3nh7d_ (3nh7 D:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)

8. Domain d3nh7d_: 3nh7 D: [239497]
   Other proteins in same PDB: d3nh7l1, d3nh7l2, d3nh7m1, d3nh7m2, d3nh7n1, d3nh7n2, d3nh7o1, d3nh7o2
   automated match to d3qb4d_

Details for d3nh7d_

PDB Entry: 3nh7, 2.7 Å

PDB Description: Crystal structure of the neutralizing Fab fragment AbD1556 bound to the BMP type I receptor IA

PDB Compounds: (D:) Bone morphogenetic protein receptor type-1A

SCOPe Domain Sequences for d3nh7d_:

Sequence; same for both SEQRES and ATOM records:

>d3nh7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv

Timeline for d3nh7d_:

• d3nh7d_ first appeared in SCOPe 2.04
  
• d3nh7d_ appears in SCOPe 2.05
  
• d3nh7d_ appears in SCOPe 2.07
  
• d3nh7d_ appears in the current release, SCOPe 2.08