![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein BMP receptor Ia ectodomain [57359] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries) |
![]() | Domain d3nh7d_: 3nh7 D: [239497] Other proteins in same PDB: d3nh7l1, d3nh7l2, d3nh7m1, d3nh7m2, d3nh7n1, d3nh7n2, d3nh7o1, d3nh7o2 automated match to d3qb4d_ |
PDB Entry: 3nh7 (more details), 2.7 Å
SCOPe Domain Sequences for d3nh7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nh7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka qlrrtieccrtnlcnqylqptlppv
Timeline for d3nh7d_: