Lineage for d3nh7b_ (3nh7 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032362Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 3032363Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 3032379Domain d3nh7b_: 3nh7 B: [239495]
    Other proteins in same PDB: d3nh7h_, d3nh7i_, d3nh7j_, d3nh7k_, d3nh7l1, d3nh7l2, d3nh7m1, d3nh7m2, d3nh7n1, d3nh7n2, d3nh7o1, d3nh7o2
    automated match to d3qb4d_

Details for d3nh7b_

PDB Entry: 3nh7 (more details), 2.7 Å

PDB Description: Crystal structure of the neutralizing Fab fragment AbD1556 bound to the BMP type I receptor IA
PDB Compounds: (B:) Bone morphogenetic protein receptor type-1A

SCOPe Domain Sequences for d3nh7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nh7b_ g.7.1.3 (B:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv

SCOPe Domain Coordinates for d3nh7b_:

Click to download the PDB-style file with coordinates for d3nh7b_.
(The format of our PDB-style files is described here.)

Timeline for d3nh7b_: