| Class g: Small proteins [56992] (94 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
| Protein BMP receptor Ia ectodomain [57359] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries) |
| Domain d3nh7a_: 3nh7 A: [239494] Other proteins in same PDB: d3nh7l1, d3nh7l2, d3nh7m1, d3nh7m2, d3nh7n1, d3nh7n2, d3nh7o1, d3nh7o2 automated match to d3qb4d_ |
PDB Entry: 3nh7 (more details), 2.7 Å
SCOPe Domain Sequences for d3nh7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nh7a_ g.7.1.3 (A:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv
Timeline for d3nh7a_: