Lineage for d3nh7a_ (3nh7 A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962289Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 1962290Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 1962307Domain d3nh7a_: 3nh7 A: [239494]
    Other proteins in same PDB: d3nh7l1, d3nh7l2, d3nh7m1, d3nh7m2, d3nh7n1, d3nh7n2, d3nh7o1, d3nh7o2
    automated match to d3qb4d_

Details for d3nh7a_

PDB Entry: 3nh7 (more details), 2.7 Å

PDB Description: Crystal structure of the neutralizing Fab fragment AbD1556 bound to the BMP type I receptor IA
PDB Compounds: (A:) Bone morphogenetic protein receptor type-1A

SCOPe Domain Sequences for d3nh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nh7a_ g.7.1.3 (A:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv

SCOPe Domain Coordinates for d3nh7a_:

Click to download the PDB-style file with coordinates for d3nh7a_.
(The format of our PDB-style files is described here.)

Timeline for d3nh7a_: