![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:544404] [233005] (2 PDB entries) |
![]() | Domain d3ncxa2: 3ncx A:841-934 [239493] Other proteins in same PDB: d3ncxa1, d3ncxb1 automated match to d3ncxb2 mutant |
PDB Entry: 3ncx (more details), 2.6 Å
SCOPe Domain Sequences for d3ncxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncxa2 d.169.1.0 (A:841-934) automated matches {Escherichia coli [TaxId: 544404]} ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss eqrsgvsstynlitqyplpgvnvntpnvyavcve
Timeline for d3ncxa2: