SCOPe 2.04: Domain d3ncxa2: 3ncx A:841-934

Lineage for d3ncxa2 (3ncx A:841-934)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:544404] [233005] (2 PDB entries)

8. Domain d3ncxa2: 3ncx A:841-934 [239493]
   Other proteins in same PDB: d3ncxa1, d3ncxb1
   automated match to d3ncxb2
   mutant

Details for d3ncxa2

PDB Entry: 3ncx, 2.6 Å

PDB Description: Crystal structure of EHEC O157:H7 intimin mutant

PDB Compounds: (A:) Intimin adherence protein

SCOPe Domain Sequences for d3ncxa2:

Sequence; same for both SEQRES and ATOM records:

>d3ncxa2 d.169.1.0 (A:841-934) automated matches {Escherichia coli [TaxId: 544404]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqyplpgvnvntpnvyavcve

Timeline for d3ncxa2:

• d3ncxa2 is new in SCOPe 2.04-stable
  
• d3ncxa2 appears in SCOPe 2.05
  
• d3ncxa2 appears in the current release, SCOPe 2.08