Lineage for d3ncbb1 (3ncb B:1-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372165Protein automated matches [190888] (2 species)
    not a true protein
  7. 2372168Species Human (Homo sapiens) [TaxId:9606] [188282] (32 PDB entries)
  8. 2372195Domain d3ncbb1: 3ncb B:1-100 [239490]
    Other proteins in same PDB: d3ncba_
    automated match to d3mzgb1
    complexed with cl, co3, na; mutant

Details for d3ncbb1

PDB Entry: 3ncb (more details), 2.1 Å

PDB Description: a mutant human prolactin receptor antagonist h180a in complex with the extracellular domain of the human prolactin receptor
PDB Compounds: (B:) Prolactin receptor

SCOPe Domain Sequences for d3ncbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncbb1 b.1.2.1 (B:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyi

SCOPe Domain Coordinates for d3ncbb1:

Click to download the PDB-style file with coordinates for d3ncbb1.
(The format of our PDB-style files is described here.)

Timeline for d3ncbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ncbb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ncba_