Lineage for d3mpsk1 (3mps K:2-134)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485319Protein automated matches [190041] (24 species)
    not a true protein
  7. 1485729Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries)
  8. 1485749Domain d3mpsk1: 3mps K:2-134 [239486]
    Other proteins in same PDB: d3mpsa2, d3mpsb2, d3mpsd2, d3mpsf2, d3mpsg2, d3mpsh2, d3mpsi2, d3mpsk2
    automated match to d3mpsa1
    complexed with fe, feo, peo

Details for d3mpsk1

PDB Entry: 3mps (more details), 2 Å

PDB Description: peroxide bound oxidized rubrerythrin from pyrococcus furiosus
PDB Compounds: (K:) rubrerythrin

SCOPe Domain Sequences for d3mpsk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpsk1 a.25.1.1 (K:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d3mpsk1:

Click to download the PDB-style file with coordinates for d3mpsk1.
(The format of our PDB-style files is described here.)

Timeline for d3mpsk1: