SCOPe 2.06: Domain d3mpsg1: 3mps G:2-134

Lineage for d3mpsg1 (3mps G:2-134)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (27 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries)

8. Domain d3mpsg1: 3mps G:2-134 [239480]
   Other proteins in same PDB: d3mpsa2, d3mpsb2, d3mpsd2, d3mpsf2, d3mpsg2, d3mpsh2, d3mpsi2, d3mpsk2
   automated match to d3mpsa1
   complexed with fe, feo, peo

Details for d3mpsg1

PDB Entry: 3mps, 2 Å

PDB Description: peroxide bound oxidized rubrerythrin from pyrococcus furiosus

PDB Compounds: (G:) rubrerythrin

SCOPe Domain Sequences for d3mpsg1:

Sequence; same for both SEQRES and ATOM records:

>d3mpsg1 a.25.1.1 (G:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

Timeline for d3mpsg1:

• d3mpsg1 first appeared in SCOPe 2.04
  
• d3mpsg1 appears in SCOPe 2.05
  
• d3mpsg1 appears in SCOPe 2.07
  
• d3mpsg1 appears in the current release, SCOPe 2.08