SCOP 1.75: Domain d5cnab_: 5cna B:

Lineage for d5cnab_ (5cna B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
   Uniprot P81461

8. Domain d5cnab_: 5cna B: [23948]

Details for d5cnab_

PDB Entry: 5cna, 2 Å

PDB Description: refined structure of concanavalin a complexed with alpha-methyl-d- mannopyranoside at 2.0 angstroms resolution and comparison with the saccharide-free structure

PDB Compounds: (B:) concanavalin a

SCOP Domain Sequences for d5cnab_:

Sequence; same for both SEQRES and ATOM records:

>d5cnab_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d5cnab_:

• d5cnab_ first appeared (with stable ids) in SCOP 1.55
  
• d5cnab_ appears in SCOP 1.73
  
• d5cnab_ appears in SCOPe 2.01
  
• d5cnab_ appears in the current release, SCOPe 2.08