Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein Mannose-specific adhesin FimH [49406] (2 species) duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
Species Escherichia coli [TaxId:562] [49407] (23 PDB entries) |
Domain d3mcyd_: 3mcy D: [239466] automated match to d3mcya_ complexed with ca, cl, gol, zh1 |
PDB Entry: 3mcy (more details), 2.9 Å
SCOPe Domain Sequences for d3mcyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcyd_ b.2.3.2 (D:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d3mcyd_: