SCOPe 2.05: Domain d3mcyc_: 3mcy C:

Lineage for d3mcyc_ (3mcy C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)

8. Domain d3mcyc_: 3mcy C: [239465]
   automated match to d3mcya_
   complexed with ca, cl, gol, zh1

Details for d3mcyc_

PDB Entry: 3mcy, 2.9 Å

PDB Description: Crystal structure of FimH lectin domain bound to biphenyl mannoside meta-methyl ester.

PDB Compounds: (C:) FimH

SCOPe Domain Sequences for d3mcyc_:

Sequence; same for both SEQRES and ATOM records:

>d3mcyc_ b.2.3.2 (C:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d3mcyc_:

• d3mcyc_ first appeared in SCOPe 2.04
  
• d3mcyc_ appears in SCOPe 2.06
  
• d3mcyc_ appears in the current release, SCOPe 2.08