Lineage for d3mbgb_ (3mbg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700461Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2700462Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 2700463Protein Augmenter of liver regeneration [89018] (2 species)
    a mammalian FAD-dependent sulfhydryl oxidase
  7. 2700464Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries)
  8. 2700468Domain d3mbgb_: 3mbg B: [239463]
    automated match to d3mbga_
    complexed with act, fad, na, zn

Details for d3mbgb_

PDB Entry: 3mbg (more details), 1.85 Å

PDB Description: crystal structure of human augmenter of liver regeneration (alr)
PDB Compounds: (B:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3mbgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbgb_ a.24.15.1 (B:) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
dcppdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfypceecaedlrkrl
arnhpdtrtraaftqwlchlhnevnrklgkpdfdcskvderwrdgwkdgscd

SCOPe Domain Coordinates for d3mbgb_:

Click to download the PDB-style file with coordinates for d3mbgb_.
(The format of our PDB-style files is described here.)

Timeline for d3mbgb_: