SCOPe 2.06: Domain d1dq5a_: 1dq5 A:

Lineage for d1dq5a_ (1dq5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (4 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (59 PDB entries)
   Uniprot P81461

8. Domain d1dq5a_: 1dq5 A: [23946]
   complexed with mn

Details for d1dq5a_

PDB Entry: 1dq5, 2 Å

PDB Description: manganese;manganese concanavalin a at ph 5.0

PDB Compounds: (A:) manganese;manganese concanavalin a (ph 5.0)

SCOPe Domain Sequences for d1dq5a_:

Sequence; same for both SEQRES and ATOM records:

>d1dq5a_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1dq5a_:

• d1dq5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dq5a_ appears in SCOPe 2.05
  
• d1dq5a_ appears in SCOPe 2.07
  
• d1dq5a_ appears in the current release, SCOPe 2.08