Lineage for d3m5kb_ (3m5k B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963526Species Parabacteroides distasonis [TaxId:435591] [232883] (1 PDB entry)
  8. 2963528Domain d3m5kb_: 3m5k B: [239456]
    automated match to d3m5ka_
    complexed with cl, fmn, unl

Details for d3m5kb_

PDB Entry: 3m5k (more details), 1.86 Å

PDB Description: crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution
PDB Compounds: (B:) Putative NADH dehydrogenase/NAD(P)H nitroreductase

SCOPe Domain Sequences for d3m5kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5kb_ d.90.1.0 (B:) automated matches {Parabacteroides distasonis [TaxId: 435591]}
enqtletilnrksvrkykdrpvekekidkliragmaapssrdrrpwefiivtdrkaldtm
aeglpfarmlketrqaivvcgdtikssnawfldcsaasqnlllaaesmglgavwtavypy
pdrieivrkelrlpdhimplnvipvgypmqketpknkynvqqihhngw

SCOPe Domain Coordinates for d3m5kb_:

Click to download the PDB-style file with coordinates for d3m5kb_.
(The format of our PDB-style files is described here.)

Timeline for d3m5kb_: