Lineage for d3m5hf_ (3m5h F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041212Domain d3m5hf_: 3m5h F: [239452]
    Other proteins in same PDB: d3m5ha_, d3m5hc_, d3m5he_
    automated match to d4n5zb_
    complexed with gol, nag

Details for d3m5hf_

PDB Entry: 3m5h (more details), 2.7 Å

PDB Description: crystal structure of a h7 influenza virus hemagglutinin complexed with 3sln
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d3m5hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5hf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnri

SCOPe Domain Coordinates for d3m5hf_:

Click to download the PDB-style file with coordinates for d3m5hf_.
(The format of our PDB-style files is described here.)

Timeline for d3m5hf_: