Lineage for d3m5gd_ (3m5g D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709488Domain d3m5gd_: 3m5g D: [239448]
    Other proteins in same PDB: d3m5ga_, d3m5gc_, d3m5ge_
    automated match to d4n5zb_
    complexed with nag, peg

Details for d3m5gd_

PDB Entry: 3m5g (more details), 2.6 Å

PDB Description: crystal structure of a h7 influenza virus hemagglutinin
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d3m5gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5gd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqi

SCOPe Domain Coordinates for d3m5gd_:

Click to download the PDB-style file with coordinates for d3m5gd_.
(The format of our PDB-style files is described here.)

Timeline for d3m5gd_: