SCOPe 2.04: Domain d3m3za1: 3m3z A:5-188

Lineage for d3m3za1 (3m3z A:5-188)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries)

8. Domain d3m3za1: 3m3z A:5-188 [239445]
   Other proteins in same PDB: d3m3zb_
   automated match to d3fzfa1
   complexed with 3f5

Details for d3m3za1

PDB Entry: 3m3z, 2.1 Å

PDB Description: Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor

PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3m3za1:

Sequence; same for both SEQRES and ATOM records:

>d3m3za1 c.55.1.0 (A:5-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
ldkk

Timeline for d3m3za1:

• d3m3za1 is new in SCOPe 2.04-stable
  
• d3m3za1 appears in SCOPe 2.05
  
• d3m3za1 appears in the current release, SCOPe 2.08