Lineage for d3lzgl_ (3lzg L:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041640Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 3041673Domain d3lzgl_: 3lzg L: [239443]
    Other proteins in same PDB: d3lzga_, d3lzgb2, d3lzgc_, d3lzge_, d3lzgg_, d3lzgi_, d3lzgk1, d3lzgk2
    automated match to d4n5zb_
    complexed with nag

Details for d3lzgl_

PDB Entry: 3lzg (more details), 2.6 Å

PDB Description: crystal structure of a 2009 h1n1 influenza virus hemagglutinin
PDB Compounds: (L:) Hemagglutinin, HA2 SUBUNIT

SCOPe Domain Sequences for d3lzgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzgl_ h.3.1.1 (L:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree

SCOPe Domain Coordinates for d3lzgl_:

Click to download the PDB-style file with coordinates for d3lzgl_.
(The format of our PDB-style files is described here.)

Timeline for d3lzgl_: