![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (36 species) not a true protein |
![]() | Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries) |
![]() | Domain d3lzgj_: 3lzg J: [239442] Other proteins in same PDB: d3lzga_, d3lzgb2, d3lzgc_, d3lzge_, d3lzgg_, d3lzgi_, d3lzgk1, d3lzgk2 automated match to d4n5zb_ complexed with nag |
PDB Entry: 3lzg (more details), 2.6 Å
SCOPe Domain Sequences for d3lzgj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lzgj_ h.3.1.1 (J:) automated matches {Influenza A virus [TaxId: 641501]} glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree
Timeline for d3lzgj_: