Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.1: Legume lectins [49900] (4 proteins) |
Protein Concanavalin A [49901] (2 species) natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop |
Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries) Uniprot P81461 |
Domain d1qdcd_: 1qdc D: [23944] complexed with ca, cl, man, mma, mn |
PDB Entry: 1qdc (more details), 2 Å
SCOP Domain Sequences for d1qdcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qdcd_ b.29.1.1 (D:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d1qdcd_: